PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00005850001
Common NameGSBRNA2T00005850001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 283aa    MW: 31016.1 Da    PI: 7.571
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00005850001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-333791155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+R 
  GSBRNA2T00005850001 37 KPRLRWTSELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRQ 91
                         79****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9743494IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-323491IPR009057Homeodomain-like
SuperFamilySSF466891.18E-163691IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-243791IPR006447Myb domain, plants
PfamPF002491.5E-73989IPR001005SANT/Myb domain
PfamPF143792.8E-26135181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MYSAIRSSLP LDGSMGEYSD GTNLPVDACL VLTTDPKPRL RWTSELHERF VDAVTQLGGP  60
DKATPKTIMR TMGVKGLTLY HLKSHLQKFR QGRQLCKEST ENSKDVSCAA ESQDTGSSST  120
SSLRLAAQEQ NESYQVTEAL RAQMEVQRRL HEQLEVQRRL QLRIEAQGKY LQSVLEKACK  180
AIEDQAVAFA GLEAAREELS ELAIKVSNGS QVPFHTTKMT VPSLSELAVA IEHKNNCSAE  240
SSLTTIPVSA TLMKRHRGVF RNGESVVVGH ETGWVMPSSS LG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.89900.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00005850001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532350.0AK353235.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-27-H18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013708595.10.0PREDICTED: myb family transcription factor APL-like isoform X2
RefseqXP_013602255.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK58e-65APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078G0C00.0A0A078G0C0_BRANA; BnaC08g08750D protein
STRINGAT4G13640.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-171G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]